SCOPe 2.01: Domain d3b94c_: 3b94 C:

Lineage for d3b94c_ (3b94 C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158984] (5 PDB entries)
   Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176

8. Domain d3b94c_: 3b94 C: [154992]
   automated match to d3b93a1

Details for d3b94c_

PDB Entry: 3b94, 2.5 Å

PDB Description: crystal structure of human gitrl

PDB Compounds: (C:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d3b94c_:

Sequence, based on SEQRES records:

>d3b94c_ b.22.1.1 (C:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr
lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqfi

Sequence, based on observed residues (ATOM records):

>d3b94c_ b.22.1.1 (C:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapfevrlyknkdmiq
tltnkiqnvggtyelhvgdtidlifntywgiillanpqfi

Timeline for d3b94c_:

• d3b94c_ first appeared in SCOP 1.75, called d3b94c1
  
• d3b94c_ appears in SCOPe 2.02
  
• d3b94c_ appears in the current release, SCOPe 2.08