SCOPe 2.02: Domain d3b93b_: 3b93 B:

Lineage for d3b93b_ (3b93 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158984] (5 PDB entries)
   Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176

8. Domain d3b93b_: 3b93 B: [154988]
   automated match to d3b93a1

Details for d3b93b_

PDB Entry: 3b93, 2.2 Å

PDB Description: crystal structure of human GITRL

PDB Compounds: (B:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d3b93b_:

Sequence, based on SEQRES records:

>d3b93b_ b.22.1.1 (B:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr
lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqfi
s

Sequence, based on observed residues (ATOM records):

>d3b93b_ b.22.1.1 (B:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmappcvnkvsdwkleilqnglyliygqvapvrlyknkdmiqtltki
qnvggtyelhvgdtidlifnsehnntywgiillanpqfis

Timeline for d3b93b_:

• d3b93b_ first appeared in SCOP 1.75, called d3b93b1
  
• d3b93b_ appears in SCOPe 2.01
  
• d3b93b_ appears in SCOPe 2.03
  
• d3b93b_ appears in the current release, SCOPe 2.08