SCOP 1.75: Domain d3b8of1: 3b8o F:55-319

Lineage for d3b8of1 (3b8o F:55-319)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.60: Bacterial polysaccharide co-polymerase-like [160355] (1 family)
   Decorated common fold with extra helical regions, which facilitate oligomerization

5. Family d.58.60.1: FepE-like [160356] (3 proteins)
   the ferredoxin-like fold resides mainly on in the N-terminal part that corresponds to Pfam PF02706 (Wzz)

6. Protein Lipopolysaccharide biosynthesis protein WzzE [160359] (1 species)

7. Species Escherichia coli [TaxId:562] [160360] (1 PDB entry)
   Uniprot P0AG01 54-318

8. Domain d3b8of1: 3b8o F:55-319 [154978]
   automatically matched to 3B8O A:55-319

Details for d3b8of1

PDB Entry: 3b8o, 2.4 Å

PDB Description: structure of wzze- bacterial polysaccharide co-polymerase

PDB Compounds: (F:) Lipopolysaccharide biosynthesis protein wzzE

SCOP Domain Sequences for d3b8of1:

Sequence, based on SEQRES records:

>d3b8of1 d.58.60.1 (F:55-319) Lipopolysaccharide biosynthesis protein WzzE {Escherichia coli [TaxId: 562]}
ewsstaitdrptvnmlggyysqqqflrnldvrsnmasadqpsvmdeaykefvmqlaswdt
rrefwlqtdyykqrmvgnskadaalldeminniqfipgdftravndsvkliaetapdann
llrqyvafasqraashlndelkgawaartiqmkaqvkrqeevakaiydrrmnsieqalki
aeqhnisrsatdvpaeelpdsemfllgrpmlqarlenlqavgpafdldydqnramlntln
vgptldprfqtyrylrtpeepvkrd

Sequence, based on observed residues (ATOM records):

>d3b8of1 d.58.60.1 (F:55-319) Lipopolysaccharide biosynthesis protein WzzE {Escherichia coli [TaxId: 562]}
ewsstaitdrptvnmlggyysqqqflrnldvpsvmdeaykefvmqlaswdtrrefwlqtd
yykqrmvgnskadaalldeminniqfipgdftravndsvkliaetapdannllrqyvafa
sqraashlndelkgawaartiqmkaqvkrqeevakaiydrrmnsieqqarlenlqavgpa
fdldydqnramlntlnvgptldprfqtyrylrtpeepvkrd

Timeline for d3b8of1:

• d3b8of1 is new in SCOP 1.75
  
• d3b8of1 is called d3b8of_ in SCOPe 2.01
  
• d3b8of1 appears in the current release, SCOPe 2.08, called d3b8of_