Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins) PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA |
Protein Uncharacterized protein Saro3538 [160045] (1 species) |
Species Novosphingobium aromaticivorans [TaxId:48935] [160046] (1 PDB entry) Uniprot A4XEN7 1-144 |
Domain d3b8le_: 3b8l E: [154959] Other proteins in same PDB: d3b8la2 automated match to d3b8la1 complexed with cl, gol, peg |
PDB Entry: 3b8l (more details), 1.75 Å
SCOPe Domain Sequences for d3b8le_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b8le_ d.17.4.28 (E:) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} mqcpiedrlaiqdlmiayahavdtvsdidavldvftedavfdlsgigltpqvghagiref ftnvfanmshhahyltnfavtgyegdtasmrayvigmgvgkdgravtvngryffevrrte kgwkatrytmdflmplsgtldnak
Timeline for d3b8le_: