SCOPe 2.07: Domain d3b7va_: 3b7v A:

Lineage for d3b7va_ (3b7v A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d3b7va_: 3b7v A: [154949]
   automated match to d1fgcc_
   complexed with cl, gol, na

Details for d3b7va_

PDB Entry: 3b7v, 1.46 Å

PDB Description: hiv-1 protease complexed with gem-diol-amine tetrahedral intermediate nlltqi

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3b7va_:

Sequence; same for both SEQRES and ATOM records:

>d3b7va_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d3b7va_:

• d3b7va_ first appeared in SCOP 1.75, called d3b7va1
  
• d3b7va_ appears in SCOPe 2.06
  
• d3b7va_ appears in the current release, SCOPe 2.08