Lineage for d3b7dd1 (3b7d D:3-261)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846372Protein Glutamate receptor ligand binding core [53881] (4 species)
  7. 846373Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (57 PDB entries)
  8. 846504Domain d3b7dd1: 3b7d D:3-261 [154932]
    automatically matched to d1mm6a_
    complexed with cni

Details for d3b7dd1

PDB Entry: 3b7d (more details), 2.5 Å

PDB Description: crystal structure of the glur2 ligand binding core (hs1s2j) in complex with cnqx at 2.5 a resolution
PDB Compounds: (D:) Glutamate receptor 2

SCOP Domain Sequences for d3b7dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7dd1 c.94.1.1 (D:3-261) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgec

SCOP Domain Coordinates for d3b7dd1:

Click to download the PDB-style file with coordinates for d3b7dd1.
(The format of our PDB-style files is described here.)

Timeline for d3b7dd1: