SCOP 1.75: Domain d3b7db1: 3b7d B:4-261

Lineage for d3b7db1 (3b7d B:4-261)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (57 PDB entries)

8. Domain d3b7db1: 3b7d B:4-261 [154930]
   automatically matched to d1mm6a_
   complexed with cni

Details for d3b7db1

PDB Entry: 3b7d, 2.5 Å

PDB Description: crystal structure of the glur2 ligand binding core (hs1s2j) in complex with cnqx at 2.5 a resolution

PDB Compounds: (B:) Glutamate receptor 2

SCOP Domain Sequences for d3b7db1:

Sequence; same for both SEQRES and ATOM records:

>d3b7db1 c.94.1.1 (B:4-261) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d3b7db1:

• d3b7db1 is new in SCOP 1.75
  
• d3b7db1 is called d3b7db_ in SCOPe 2.01
  
• d3b7db1 appears in the current release, SCOPe 2.08, called d3b7db_