Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
Protein Glutamate receptor ligand binding core [53881] (4 species) |
Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (57 PDB entries) |
Domain d3b7db1: 3b7d B:4-261 [154930] automatically matched to d1mm6a_ complexed with cni |
PDB Entry: 3b7d (more details), 2.5 Å
SCOP Domain Sequences for d3b7db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7db1 c.94.1.1 (B:4-261) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne qglldklknkwwydkgec
Timeline for d3b7db1: