Lineage for d3b7ca1 (3b7c A:1-121)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937032Family d.17.4.16: SO0125-like [159991] (2 proteins)
    PfamB PB003666
    automatically mapped to Pfam PF13474
  6. 2937041Protein Uncharacterized protein SO0125 [159994] (1 species)
  7. 2937042Species Shewanella oneidensis [TaxId:70863] [159995] (1 PDB entry)
    Uniprot Q8EKG8 1-121
  8. 2937043Domain d3b7ca1: 3b7c A:1-121 [154928]
    complexed with cl, edo

Details for d3b7ca1

PDB Entry: 3b7c (more details), 1.7 Å

PDB Description: crystal structure of a ntf-2 like protein of unknown function (so_0125) from shewanella oneidensis mr-1 at 1.70 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3b7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]}
mptddivqllkgqeeawnrgdldaymqgywqneqlmlisngkfrngwdetlaaykknypd
keslgelkftikeikmlsnyaamvvgrwdlkrlkdtptgvftllvekiddrwvitmdhss
d

SCOPe Domain Coordinates for d3b7ca1:

Click to download the PDB-style file with coordinates for d3b7ca1.
(The format of our PDB-style files is described here.)

Timeline for d3b7ca1: