![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.16: SO0125-like [159991] (2 proteins) PfamB PB003666 automatically mapped to Pfam PF13474 |
![]() | Protein Uncharacterized protein SO0125 [159994] (1 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [159995] (1 PDB entry) Uniprot Q8EKG8 1-121 |
![]() | Domain d3b7ca1: 3b7c A:1-121 [154928] complexed with cl, edo |
PDB Entry: 3b7c (more details), 1.7 Å
SCOPe Domain Sequences for d3b7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} mptddivqllkgqeeawnrgdldaymqgywqneqlmlisngkfrngwdetlaaykknypd keslgelkftikeikmlsnyaamvvgrwdlkrlkdtptgvftllvekiddrwvitmdhss d
Timeline for d3b7ca1: