Lineage for d3b7ba1 (3b7b A:879-954)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685843Species Human (Homo sapiens) [TaxId:9606] [187689] (7 PDB entries)
  8. 1685859Domain d3b7ba1: 3b7b A:879-954 [154927]
    automatically matched to d1n0qb_
    complexed with so4

Details for d3b7ba1

PDB Entry: 3b7b (more details), 2.99 Å

PDB Description: EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 1)
PDB Compounds: (A:) Euchromatic histone-lysine N-methyltransferase 1

SCOPe Domain Sequences for d3b7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7ba1 d.211.1.1 (A:879-954) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhwaafsgcvdiaeillaakcdlhavnihgdsplhiaarenrydcvvlflsrdsdvtlkn
kegetplqcaslnsqv

SCOPe Domain Coordinates for d3b7ba1:

Click to download the PDB-style file with coordinates for d3b7ba1.
(The format of our PDB-style files is described here.)

Timeline for d3b7ba1: