Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (177 PDB entries) Uniprot P68871 |
Domain d3b75f1: 3b75 F:1-146 [154918] automatically matched to d1dxtb_ complexed with fru, glc, hem, oxy, po4 |
PDB Entry: 3b75 (more details), 2.3 Å
SCOP Domain Sequences for d3b75f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b75f1 a.1.1.2 (F:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d3b75f1:
View in 3D Domains from other chains: (mouse over for more information) d3b75b1, d3b75d1, d3b75h1, d3b75t1 |