SCOPe 2.06: Domain d3b71b_: 3b71 B:

Lineage for d3b71b_ (3b71 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
   automatically mapped to Pfam PF03623

6. Protein automated matches [190364] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187198] (3 PDB entries)

8. Domain d3b71b_: 3b71 B: [154913]
   automated match to d1k04a_

Details for d3b71b_

PDB Entry: 3b71, 2.82 Å

PDB Description: CD4 endocytosis motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase

PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d3b71b_:

Sequence; same for both SEQRES and ATOM records:

>d3b71b_ a.24.14.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatv
detipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahala
vdaknlldvidqarlkmlg

Timeline for d3b71b_:

• d3b71b_ first appeared in SCOP 1.75, called d3b71b1
  
• d3b71b_ appears in SCOPe 2.05
  
• d3b71b_ appears in SCOPe 2.07
  
• d3b71b_ appears in the current release, SCOPe 2.08