![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) ![]() |
![]() | Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins) automatically mapped to Pfam PF03623 |
![]() | Protein automated matches [190364] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187198] (4 PDB entries) |
![]() | Domain d3b71a_: 3b71 A: [154912] automated match to d1k04a_ |
PDB Entry: 3b71 (more details), 2.82 Å
SCOPe Domain Sequences for d3b71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b71a_ a.24.14.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipll pasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahalavdaknll dvidqarlkmlgqt
Timeline for d3b71a_: