SCOPe 2.06: Domain d3b6sa2: 3b6s A:1-181

Lineage for d3b6sa2 (3b6s A:1-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
   Uniprot P30481 25-300

8. Domain d3b6sa2: 3b6s A:1-181 [154910]
   Other proteins in same PDB: d3b6sa1, d3b6sb2, d3b6sb3
   automatically matched to d1m6oa2

Details for d3b6sa2

PDB Entry: 3b6s, 1.8 Å

PDB Description: crystal structure of hla-b*2705 complexed with the citrullinated vasoactive intestinal peptide type 1 receptor (vipr) peptide (residues 400-408)

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOPe Domain Sequences for d3b6sa2:

Sequence; same for both SEQRES and ATOM records:

>d3b6sa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d3b6sa2:

• d3b6sa2 first appeared in SCOP 1.75
  
• d3b6sa2 appears in SCOPe 2.05
  
• d3b6sa2 appears in SCOPe 2.07
  
• d3b6sa2 appears in the current release, SCOPe 2.08