Lineage for d3b6pc_ (3b6p C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860371Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)
  8. 1860384Domain d3b6pc_: 3b6p C: [154907]
    automated match to d1y97a1
    protein/DNA complex; complexed with na, tmp, zn

Details for d3b6pc_

PDB Entry: 3b6p (more details), 2.3 Å

PDB Description: Structure of TREX1 in complex with a nucleotide and inhibitor ions (sodium and zinc)
PDB Compounds: (C:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3b6pc_:

Sequence, based on SEQRES records: (download)

>d3b6pc_ c.55.3.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw
qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records): (download)

>d3b6pc_ c.55.3.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
egdvltllsicqwkpqallqwvdeharpfstvkpmyg

SCOPe Domain Coordinates for d3b6pc_:

Click to download the PDB-style file with coordinates for d3b6pc_.
(The format of our PDB-style files is described here.)

Timeline for d3b6pc_: