Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries) |
Domain d3b6pa_: 3b6p A: [154905] automated match to d1y97a1 protein/DNA complex; complexed with na, tmp, zn |
PDB Entry: 3b6p (more details), 2.3 Å
SCOPe Domain Sequences for d3b6pa_:
Sequence, based on SEQRES records: (download)
>d3b6pa_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg
>d3b6pa_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta egdvltllsicqwkpqallqwvdeharpfstvkpmyg
Timeline for d3b6pa_: