SCOPe 2.07: Domain d3b6od_: 3b6o D:

Lineage for d3b6od_ (3b6o D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)

8. Domain d3b6od_: 3b6o D: [154904]
   automated match to d1y97a1
   protein/DNA complex; complexed with li, tmp

Details for d3b6od_

PDB Entry: 3b6o, 2.1 Å

PDB Description: Structure of TREX1 in complex with a nucleotide and an inhibitor ion (lithium)

PDB Compounds: (D:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3b6od_:

Sequence, based on SEQRES records:

>d3b6od_ c.55.3.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw
qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d3b6od_ c.55.3.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
egdvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d3b6od_:

• d3b6od_ first appeared in SCOP 1.75, called d3b6od1
  
• d3b6od_ appears in SCOPe 2.06
  
• d3b6od_ appears in the current release, SCOPe 2.08