Lineage for d3b6gc1 (3b6g C:15-118)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482600Protein Histone H2A [47115] (6 species)
  7. 1482601Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (34 PDB entries)
  8. 1482670Domain d3b6gc1: 3b6g C:15-118 [154894]
    Other proteins in same PDB: d3b6ga1, d3b6gb1, d3b6gd1, d3b6ge1, d3b6gf1, d3b6gh1
    automatically matched to d1aoic_
    protein/DNA complex; complexed with mn

Details for d3b6gc1

PDB Entry: 3b6g (more details), 3.45 Å

PDB Description: Nucleosome core particle treated with oxaliplatin
PDB Compounds: (C:) histone h2a

SCOPe Domain Sequences for d3b6gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6gc1 a.22.1.1 (C:15-118) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d3b6gc1:

Click to download the PDB-style file with coordinates for d3b6gc1.
(The format of our PDB-style files is described here.)

Timeline for d3b6gc1: