Lineage for d3b6ga1 (3b6g A:33-135)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482793Protein Histone H3 [47122] (6 species)
  7. 1482794Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1482870Domain d3b6ga1: 3b6g A:33-135 [154892]
    Other proteins in same PDB: d3b6gb1, d3b6gc1, d3b6gd1, d3b6gf1, d3b6gg1, d3b6gh1
    automatically matched to d1aoie_
    protein/DNA complex; complexed with mn

Details for d3b6ga1

PDB Entry: 3b6g (more details), 3.45 Å

PDB Description: Nucleosome core particle treated with oxaliplatin
PDB Compounds: (A:) Histone H3.2

SCOPe Domain Sequences for d3b6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6ga1 a.22.1.1 (A:33-135) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmal
qeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d3b6ga1:

Click to download the PDB-style file with coordinates for d3b6ga1.
(The format of our PDB-style files is described here.)

Timeline for d3b6ga1: