![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries) |
![]() | Domain d3b6fe1: 3b6f E:33-135 [154888] Other proteins in same PDB: d3b6fb1, d3b6fc1, d3b6fd1, d3b6ff1, d3b6fg1, d3b6fh1 automatically matched to d1aoie_ protein/DNA complex; complexed with mn |
PDB Entry: 3b6f (more details), 3.45 Å
SCOPe Domain Sequences for d3b6fe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6fe1 a.22.1.1 (E:33-135) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} ggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmal qeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d3b6fe1: