Lineage for d3b6fb1 (3b6f B:24-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698447Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 2698529Domain d3b6fb1: 3b6f B:24-102 [154885]
    Other proteins in same PDB: d3b6fa1, d3b6fc1, d3b6fd1, d3b6fe1, d3b6fg1, d3b6fh1
    automatically matched to d1p3ob_
    protein/DNA complex; complexed with mn

Details for d3b6fb1

PDB Entry: 3b6f (more details), 3.45 Å

PDB Description: Nucleosome core particle treated with cisplatin
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d3b6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6fb1 a.22.1.1 (B:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d3b6fb1:

Click to download the PDB-style file with coordinates for d3b6fb1.
(The format of our PDB-style files is described here.)

Timeline for d3b6fb1: