Lineage for d3b69a2 (3b69 A:1-399)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065231Protein Trypanosoma sialidase [82164] (2 species)
  7. 2065232Species Trypanosoma cruzi [TaxId:5693] [89371] (13 PDB entries)
    Uniprot Q26966
  8. 2065238Domain d3b69a2: 3b69 A:1-399 [154881]
    Other proteins in same PDB: d3b69a1, d3b69a3
    automated match to d1ms8a2
    complexed with bfn, cl, epe

Details for d3b69a2

PDB Entry: 3b69 (more details), 1.67 Å

PDB Description: T cruzi Trans-sialidase complex with benzoylated NANA derivative
PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d3b69a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b69a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Trypanosoma cruzi [TaxId: 5693]}
lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
nevyslvfarlvgelriiksvlqswknwdshlssictpa

SCOPe Domain Coordinates for d3b69a2:

Click to download the PDB-style file with coordinates for d3b69a2.
(The format of our PDB-style files is described here.)

Timeline for d3b69a2: