Lineage for d3b69a1 (3b69 A:409-633)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781646Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 1781647Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 1781648Species Trypanosoma cruzi [TaxId:5693] [89271] (12 PDB entries)
    Uniprot Q26966
  8. 1781653Domain d3b69a1: 3b69 A:409-633 [154880]
    Other proteins in same PDB: d3b69a2
    automated match to d1ms8a1
    complexed with bfn, cl, epe

Details for d3b69a1

PDB Entry: 3b69 (more details), 1.67 Å

PDB Description: t cruzi trans-sialidase complex with benzoylated nana derivative
PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d3b69a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b69a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Trypanosoma cruzi [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahm

SCOPe Domain Coordinates for d3b69a1:

Click to download the PDB-style file with coordinates for d3b69a1.
(The format of our PDB-style files is described here.)

Timeline for d3b69a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b69a2