Lineage for d3b67a_ (3b67 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2341333Protein Androgen receptor [63621] (4 species)
  7. 2341343Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. 2341364Domain d3b67a_: 3b67 A: [154878]
    automated match to d1xowa_
    protein/DNA complex; complexed with b67

Details for d3b67a_

PDB Entry: 3b67 (more details), 1.9 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with SARM C-23
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d3b67a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b67a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfh

SCOPe Domain Coordinates for d3b67a_:

Click to download the PDB-style file with coordinates for d3b67a_.
(The format of our PDB-style files is described here.)

Timeline for d3b67a_: