Lineage for d3b66a_ (3b66 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728287Protein Androgen receptor [63621] (4 species)
  7. 2728297Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. 2728302Domain d3b66a_: 3b66 A: [154877]
    automated match to d1xowa_
    protein/DNA complex; complexed with b66

Details for d3b66a_

PDB Entry: 3b66 (more details), 1.65 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with SARM S-21
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d3b66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b66a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfh

SCOPe Domain Coordinates for d3b66a_:

Click to download the PDB-style file with coordinates for d3b66a_.
(The format of our PDB-style files is described here.)

Timeline for d3b66a_: