SCOPe 2.01: Domain d3b60c2: 3b60 C:10-328

Lineage for d3b60c2 (3b60 C:10-328)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
   multihelical; complex architecture with several transmembrane helices

4. Superfamily f.37.1: ABC transporter transmembrane region [90123] (1 family)

5. Family f.37.1.1: ABC transporter transmembrane region [90124] (2 proteins)

6. Protein Multidrug resistance ABC transporter MsbA, N-terminal domain [90125] (1 species)
   a low-resolution structure of the E.coli MsbA in an open conformation is also available (f.35.1.1)

7. Species Salmonella typhimurium [TaxId:90371] [161075] (3 PDB entries)
   Uniprot P63359 10-328

8. Domain d3b60c2: 3b60 C:10-328 [154873]
   Other proteins in same PDB: d3b60a1, d3b60b1, d3b60c1, d3b60d1
   automatically matched to 3B60 A:10-328
   complexed with anp

Details for d3b60c2

PDB Entry: 3b60, 3.7 Å

PDB Description: Crystal Structure of MsbA from Salmonella typhimurium with AMPPNP, higher resolution form

PDB Compounds: (C:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d3b60c2:

Sequence; same for both SEQRES and ATOM records:

>d3b60c2 f.37.1.1 (C:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
wqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktdrsvllwmpl
vviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtllsrit
ydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvskrf
rsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvsass
isdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvnaqfq
rgmaacqtlfaildseqek

Timeline for d3b60c2:

• d3b60c2 first appeared in SCOP 1.75
  
• d3b60c2 appears in SCOPe 2.02
  
• d3b60c2 appears in the current release, SCOPe 2.08