SCOP 1.75: Domain d3b60c1: 3b60 C:329-581

Lineage for d3b60c1 (3b60 C:329-581)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (2 species)
   a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)
   a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)

7. Species Salmonella typhimurium [TaxId:90371] [159568] (3 PDB entries)
   Uniprot P63359 329-581

8. Domain d3b60c1: 3b60 C:329-581 [154872]
   Other proteins in same PDB: d3b60a2, d3b60b2, d3b60c2, d3b60d2
   automatically matched to 3B60 A:329-581
   complexed with anp

Details for d3b60c1

PDB Entry: 3b60, 3.7 Å

PDB Description: Crystal Structure of MsbA from Salmonella typhimurium with AMPPNP, higher resolution form

PDB Compounds: (C:) Lipid A export ATP-binding/permease protein msbA

SCOP Domain Sequences for d3b60c1:

Sequence; same for both SEQRES and ATOM records:

>d3b60c1 c.37.1.12 (C:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
degkrvidratgdlefrnvtftypgrevpalrninlkipagktvalvgrsgsgkstiasl
itrfydideghilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteeysre
qieeaarmayamdfinkmdngldtiigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstieqadeivvvedgiivergthsellaq
hgvyaqlhkmqfg

Timeline for d3b60c1:

• d3b60c1 is new in SCOP 1.75
  
• d3b60c1 appears in SCOPe 2.01
  
• d3b60c1 appears in the current release, SCOPe 2.08