Lineage for d3b60a2 (3b60 A:10-328)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060882Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 1060883Superfamily f.37.1: ABC transporter transmembrane region [90123] (1 family) (S)
  5. 1060884Family f.37.1.1: ABC transporter transmembrane region [90124] (2 proteins)
  6. 1060885Protein Multidrug resistance ABC transporter MsbA, N-terminal domain [90125] (1 species)
    a low-resolution structure of the E.coli MsbA in an open conformation is also available (f.35.1.1)
  7. 1060886Species Salmonella typhimurium [TaxId:90371] [161075] (3 PDB entries)
    Uniprot P63359 10-328
  8. 1060887Domain d3b60a2: 3b60 A:10-328 [154869]
    Other proteins in same PDB: d3b60a1, d3b60b1, d3b60c1, d3b60d1
    complexed with anp

Details for d3b60a2

PDB Entry: 3b60 (more details), 3.7 Å

PDB Description: Crystal Structure of MsbA from Salmonella typhimurium with AMPPNP, higher resolution form
PDB Compounds: (A:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d3b60a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
wqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktdrsvllwmpl
vviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtllsrit
ydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvskrf
rsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvsass
isdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvnaqfq
rgmaacqtlfaildseqek

SCOPe Domain Coordinates for d3b60a2:

Click to download the PDB-style file with coordinates for d3b60a2.
(The format of our PDB-style files is described here.)

Timeline for d3b60a2: