| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily) multihelical; complex architecture with several transmembrane helices |
Superfamily f.37.1: ABC transporter transmembrane region [90123] (1 family) ![]() |
| Family f.37.1.1: ABC transporter transmembrane region [90124] (2 proteins) |
| Protein Multidrug resistance ABC transporter MsbA, N-terminal domain [90125] (2 species) a low-resolution structure of the E.coli MsbA in an open conformation is also available (f.35.1.1) a low-resolution structure of the E.coli MsbA in an open conformation is also available (f.35.1.1) |
| Species Salmonella typhimurium [TaxId:90371] [161075] (3 PDB entries) Uniprot P63359 10-328 |
| Domain d3b60a2: 3b60 A:10-328 [154869] Other proteins in same PDB: d3b60a1, d3b60b1, d3b60c1, d3b60d1 complexed with anp |
PDB Entry: 3b60 (more details), 3.7 Å
SCOP Domain Sequences for d3b60a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
wqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktdrsvllwmpl
vviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtllsrit
ydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvskrf
rsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlqgmkmvsass
isdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltnvnaqfq
rgmaacqtlfaildseqek
Timeline for d3b60a2: