Lineage for d3b60a1 (3b60 A:329-581)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870337Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (1 species)
    a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)
  7. 2870338Species Salmonella typhimurium [TaxId:90371] [159568] (3 PDB entries)
    Uniprot P63359 329-581
  8. 2870339Domain d3b60a1: 3b60 A:329-581 [154868]
    Other proteins in same PDB: d3b60a2, d3b60b2, d3b60c2, d3b60d2
    complexed with anp

Details for d3b60a1

PDB Entry: 3b60 (more details), 3.7 Å

PDB Description: Crystal Structure of MsbA from Salmonella typhimurium with AMPPNP, higher resolution form
PDB Compounds: (A:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d3b60a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
degkrvidratgdlefrnvtftypgrevpalrninlkipagktvalvgrsgsgkstiasl
itrfydideghilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteeysre
qieeaarmayamdfinkmdngldtiigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstieqadeivvvedgiivergthsellaq
hgvyaqlhkmqfg

SCOPe Domain Coordinates for d3b60a1:

Click to download the PDB-style file with coordinates for d3b60a1.
(The format of our PDB-style files is described here.)

Timeline for d3b60a1: