| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
| Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (1 species) a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1) |
| Species Salmonella typhimurium [TaxId:90371] [159568] (3 PDB entries) Uniprot P63359 329-581 |
| Domain d3b5za1: 3b5z A:329-581 [154860] Other proteins in same PDB: d3b5za2, d3b5zb2, d3b5zc2, d3b5zd2 automatically matched to 3B60 A:329-581 complexed with adp, vo4 |
PDB Entry: 3b5z (more details), 4.2 Å
SCOPe Domain Sequences for d3b5za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5za1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
degkrvidratgdlefrnvtftypgrevpalrninlkipagktvalvgrsgsgkstiasl
itrfydideghilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteeysre
qieeaarmayamdfinkmdngldtiigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstieqadeivvvedgiivergthsellaq
hgvyaqlhkmqfg
Timeline for d3b5za1: