SCOPe 2.05: Domain d3b5yb1: 3b5y B:329-581

Lineage for d3b5yb1 (3b5y B:329-581)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (1 species)
   a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)

7. Species Salmonella typhimurium [TaxId:90371] [159568] (3 PDB entries)
   Uniprot P63359 329-581

8. Domain d3b5yb1: 3b5y B:329-581 [154854]
   Other proteins in same PDB: d3b5ya2, d3b5yb2, d3b5yc2, d3b5yd2
   automatically matched to 3B60 A:329-581
   complexed with anp

Details for d3b5yb1

PDB Entry: 3b5y, 4.5 Å

PDB Description: Crystal Structure of MsbA from Salmonella typhimurium with AMPPNP

PDB Compounds: (B:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d3b5yb1:

Sequence; same for both SEQRES and ATOM records:

>d3b5yb1 c.37.1.12 (B:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
degkrvidratgdlefrnvtftypgrevpalrninlkipagktvalvgrsgsgkstiasl
itrfydideghilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteeysre
qieeaarmayamdfinkmdngldtiigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstieqadeivvvedgiivergthsellaq
hgvyaqlhkmqfg

Timeline for d3b5yb1:

• d3b5yb1 first appeared in SCOP 1.75
  
• d3b5yb1 appears in SCOPe 2.04
  
• d3b5yb1 appears in SCOPe 2.06
  
• d3b5yb1 appears in the current release, SCOPe 2.08