Lineage for d3b5yb1 (3b5y B:329-581)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831595Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 831751Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (2 species)
    a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)
    a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)
  7. 831752Species Salmonella typhimurium [TaxId:90371] [159568] (3 PDB entries)
    Uniprot P63359 329-581
  8. 831758Domain d3b5yb1: 3b5y B:329-581 [154854]
    Other proteins in same PDB: d3b5ya2, d3b5yb2, d3b5yc2, d3b5yd2
    automatically matched to 3B60 A:329-581
    complexed with anp

Details for d3b5yb1

PDB Entry: 3b5y (more details), 4.5 Å

PDB Description: Crystal Structure of MsbA from Salmonella typhimurium with AMPPNP
PDB Compounds: (B:) Lipid A export ATP-binding/permease protein msbA

SCOP Domain Sequences for d3b5yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5yb1 c.37.1.12 (B:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
degkrvidratgdlefrnvtftypgrevpalrninlkipagktvalvgrsgsgkstiasl
itrfydideghilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteeysre
qieeaarmayamdfinkmdngldtiigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstieqadeivvvedgiivergthsellaq
hgvyaqlhkmqfg

SCOP Domain Coordinates for d3b5yb1:

Click to download the PDB-style file with coordinates for d3b5yb1.
(The format of our PDB-style files is described here.)

Timeline for d3b5yb1: