![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.15: SNARE fusion complex [58038] (1 family) ![]() tetrameric parallel coiled coil |
![]() | Family h.1.15.1: SNARE fusion complex [58039] (11 proteins) |
![]() | Protein Syntaxin 1A [88908] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161254] (1 PDB entry) |
![]() | Domain d3b5nj1: 3b5n J:191-254 [154850] Other proteins in same PDB: d3b5na1, d3b5nc1 automatically matched to d1sfcj_ |
PDB Entry: 3b5n (more details), 1.6 Å
SCOPe Domain Sequences for d3b5nj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5nj1 h.1.15.1 (J:191-254) Syntaxin 1A {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvghtd kavk
Timeline for d3b5nj1:
![]() Domains from other chains: (mouse over for more information) d3b5na1, d3b5nb1, d3b5nc1, d3b5nf1 |