| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
| Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
| Protein Syntaxin 1A [88908] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161254] (1 PDB entry) |
| Domain d3b5nf_: 3b5n F: [154849] Other proteins in same PDB: d3b5na_, d3b5nc_, d3b5ne_, d3b5ng_, d3b5ni_, d3b5nk_ automated match to d3b5nb1 |
PDB Entry: 3b5n (more details), 1.6 Å
SCOPe Domain Sequences for d3b5nf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5nf_ h.1.15.1 (F:) Syntaxin 1A {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
tdkavksa
Timeline for d3b5nf_: