SCOP 1.75: Domain d3b5nf1: 3b5n F:189-254

Lineage for d3b5nf1 (3b5n F:189-254)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (1 family)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (11 proteins)

6. Protein Syntaxin 1A [88908] (3 species)

7. Species Saccharomyces cerevisiae [TaxId:4932] [161254] (1 PDB entry)

8. Domain d3b5nf1: 3b5n F:189-254 [154849]
   Other proteins in same PDB: d3b5na1, d3b5nc1
   automatically matched to d1sfcj_

Details for d3b5nf1

PDB Entry: 3b5n, 1.6 Å

PDB Description: structure of the yeast plasma membrane snare complex

PDB Compounds: (F:) Protein SSO1

SCOP Domain Sequences for d3b5nf1:

Sequence; same for both SEQRES and ATOM records:

>d3b5nf1 h.1.15.1 (F:189-254) Syntaxin 1A {Saccharomyces cerevisiae [TaxId: 4932]}
alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
tdkavk

Timeline for d3b5nf1:

• d3b5nf1 is new in SCOP 1.75
  
• d3b5nf1 appears in SCOPe 2.01
  
• d3b5nf1 appears in the current release, SCOPe 2.08, called d3b5nf_