Lineage for d3b5nf1 (3b5n F:189-254)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895509Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 895510Family h.1.15.1: SNARE fusion complex [58039] (11 proteins)
  6. 895560Protein Syntaxin 1A [88908] (3 species)
  7. 895576Species Saccharomyces cerevisiae [TaxId:4932] [161254] (1 PDB entry)
  8. 895578Domain d3b5nf1: 3b5n F:189-254 [154849]
    Other proteins in same PDB: d3b5na1, d3b5nc1
    automatically matched to d1sfcj_

Details for d3b5nf1

PDB Entry: 3b5n (more details), 1.6 Å

PDB Description: structure of the yeast plasma membrane snare complex
PDB Compounds: (F:) Protein SSO1

SCOP Domain Sequences for d3b5nf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5nf1 h.1.15.1 (F:189-254) Syntaxin 1A {Saccharomyces cerevisiae [TaxId: 4932]}
alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
tdkavk

SCOP Domain Coordinates for d3b5nf1:

Click to download the PDB-style file with coordinates for d3b5nf1.
(The format of our PDB-style files is described here.)

Timeline for d3b5nf1: