Lineage for d3b5nb_ (3b5n B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266412Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2266413Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2266482Protein Syntaxin 1A [88908] (3 species)
  7. 2266483Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161254] (1 PDB entry)
  8. 2266484Domain d3b5nb_: 3b5n B: [154847]
    Other proteins in same PDB: d3b5na2, d3b5na3, d3b5nc2, d3b5nc3, d3b5nc4, d3b5ne_, d3b5ng1, d3b5ng2, d3b5ni_, d3b5nk_
    automated match to d3b5nb1

Details for d3b5nb_

PDB Entry: 3b5n (more details), 1.6 Å

PDB Description: structure of the yeast plasma membrane snare complex
PDB Compounds: (B:) Protein SSO1

SCOPe Domain Sequences for d3b5nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5nb_ h.1.15.1 (B:) Syntaxin 1A {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
alaevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvgh
tdkavksar

SCOPe Domain Coordinates for d3b5nb_:

Click to download the PDB-style file with coordinates for d3b5nb_.
(The format of our PDB-style files is described here.)

Timeline for d3b5nb_: