![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Cervical EMMPRIN [158877] (1 species) contains two Ig-domains in the N-terminal part |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158878] (1 PDB entry) Uniprot Q54A51 103-203! Uniprot Q54A51 23-102 |
![]() | Domain d3b5hc1: 3b5h C:103-202 [154842] automated match to d3b5ha1 complexed with act |
PDB Entry: 3b5h (more details), 2.8 Å
SCOPe Domain Sequences for d3b5hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5hc1 b.1.1.4 (C:103-202) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} gpprvkavkssehinegetamlvcksesvppvtdwawykitdsedkalmngsesrffvss sqgrselhienlnmeadpgqyrcngtsskgsdqaiitlrv
Timeline for d3b5hc1: