Lineage for d3b5eb_ (3b5e B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900680Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 2900699Protein Uncharacterized protein Mll8374 [159738] (1 species)
  7. 2900700Species Mesorhizobium loti [TaxId:381] [159739] (1 PDB entry)
    Uniprot Q983D6 7-215
  8. 2900702Domain d3b5eb_: 3b5e B: [154837]
    automated match to d3b5ea1
    complexed with edo, so4

Details for d3b5eb_

PDB Entry: 3b5e (more details), 1.75 Å

PDB Description: crystal structure of carboxylesterase (np_108484.1) from mesorhizobium loti at 1.75 a resolution
PDB Compounds: (B:) Mll8374 protein

SCOPe Domain Sequences for d3b5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5eb_ c.69.1.14 (B:) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}
gdgiensplltdlafpyrllgagkesreclfllhgsgvdettlvplarriaptatlvaar
gripqedgfrwferidptrfeqksilaetaafaaftneaakrhglnldhatflgysngan
lvsslmllhpgivrlaallrpmpvldhvpatdlagirtliiagaadetygpfvpalvtll
srhgaevdariipsghdigdpdaaivrqwlagp

SCOPe Domain Coordinates for d3b5eb_:

Click to download the PDB-style file with coordinates for d3b5eb_.
(The format of our PDB-style files is described here.)

Timeline for d3b5eb_: