![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins) |
![]() | Protein Uncharacterized protein Mll8374 [159738] (1 species) |
![]() | Species Mesorhizobium loti [TaxId:381] [159739] (1 PDB entry) Uniprot Q983D6 7-215 |
![]() | Domain d3b5eb_: 3b5e B: [154837] automated match to d3b5ea1 complexed with edo, so4 |
PDB Entry: 3b5e (more details), 1.75 Å
SCOPe Domain Sequences for d3b5eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5eb_ c.69.1.14 (B:) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} gdgiensplltdlafpyrllgagkesreclfllhgsgvdettlvplarriaptatlvaar gripqedgfrwferidptrfeqksilaetaafaaftneaakrhglnldhatflgysngan lvsslmllhpgivrlaallrpmpvldhvpatdlagirtliiagaadetygpfvpalvtll srhgaevdariipsghdigdpdaaivrqwlagp
Timeline for d3b5eb_: