SCOPe 2.07: Domain d3b5ea1: 3b5e A:7-215

Lineage for d3b5ea1 (3b5e A:7-215)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 protein domains)

6. Protein Uncharacterized protein Mll8374 [159738] (1 species)

7. Species Mesorhizobium loti [TaxId:381] [159739] (1 PDB entry)
   Uniprot Q983D6 7-215

8. Domain d3b5ea1: 3b5e A:7-215 [154836]
   complexed with edo, so4

Details for d3b5ea1

PDB Entry: 3b5e, 1.75 Å

PDB Description: crystal structure of carboxylesterase (np_108484.1) from mesorhizobium loti at 1.75 a resolution

PDB Compounds: (A:) Mll8374 protein

SCOPe Domain Sequences for d3b5ea1:

Sequence; same for both SEQRES and ATOM records:

>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}
ensplltdlafpyrllgagkesreclfllhgsgvdettlvplarriaptatlvaargrip
qedgfrwferidptrfeqksilaetaafaaftneaakrhglnldhatflgysnganlvss
lmllhpgivrlaallrpmpvldhvpatdlagirtliiagaadetygpfvpalvtllsrhg
aevdariipsghdigdpdaaivrqwlagp

Timeline for d3b5ea1:

• d3b5ea1 first appeared in SCOP 1.75
  
• d3b5ea1 appears in SCOPe 2.06