Lineage for d3b56b1 (3b56 B:11-124)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790527Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 790528Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 790529Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 790550Species Human (Homo sapiens) [TaxId:9606] [49475] (79 PDB entries)
    Uniprot P02766 31-143
  8. 790576Domain d3b56b1: 3b56 B:11-124 [154834]
    automatically matched to d1bzda_
    complexed with diu

Details for d3b56b1

PDB Entry: 3b56 (more details), 1.55 Å

PDB Description: Crystal structure of transthyretin in complex with 3,5-diiodosalicylic acid
PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d3b56b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b56b1 b.3.4.1 (B:11-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOP Domain Coordinates for d3b56b1:

Click to download the PDB-style file with coordinates for d3b56b1.
(The format of our PDB-style files is described here.)

Timeline for d3b56b1: