SCOPe 2.08: Domain d3b48f2: 3b48 F:1-132

Lineage for d3b48f2 (3b48 F:1-132)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.2: DhaM-like [159618] (2 proteins)
   probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily (82549)
   automatically mapped to Pfam PF03610

6. Protein Uncharacterized protein EF1359 [159619] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [159620] (1 PDB entry)
   Uniprot Q835L8 1-132

8. Domain d3b48f2: 3b48 F:1-132 [154823]
   Other proteins in same PDB: d3b48c3, d3b48d3, d3b48e3, d3b48f3
   automated match to d3b48a1

Details for d3b48f2

PDB Entry: 3b48, 2.21 Å

PDB Description: Crystal structure of unknown function protein EF1359

PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d3b48f2:

Sequence; same for both SEQRES and ATOM records:

>d3b48f2 c.54.1.2 (F:1-132) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
mkadillvshskmitdgikemieqmnaseeitihslggtsdgslgsdpmkiidtineads
dreflifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqil
aeaqnagkkgwn

Timeline for d3b48f2:

• d3b48f2 first appeared in SCOP 1.75, called d3b48f1
  
• d3b48f2 appears in SCOPe 2.07