Lineage for d3b48e1 (3b48 E:1-131)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835914Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 835915Superfamily c.54.1: PTS system fructose IIA component-like [53062] (2 families) (S)
    active dimer is formed by strand 5 swapping
  5. 835930Family c.54.1.2: DhaM-like [159618] (2 proteins)
    probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily ((82549))
    probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily ((82549))
  6. 835937Protein Uncharacterized protein EF1359 [159619] (1 species)
  7. 835938Species Enterococcus faecalis [TaxId:1351] [159620] (1 PDB entry)
    Uniprot Q835L8 1-132
  8. 835943Domain d3b48e1: 3b48 E:1-131 [154822]
    automatically matched to 3B48 A:1-132

Details for d3b48e1

PDB Entry: 3b48 (more details), 2.21 Å

PDB Description: Crystal structure of unknown function protein EF1359
PDB Compounds: (E:) Uncharacterized protein

SCOP Domain Sequences for d3b48e1:

Sequence, based on SEQRES records: (download)

>d3b48e1 c.54.1.2 (E:1-131) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
mkadillvshskmitdgikemieqmnaseeitihslggtsdgslgsdpmkiidtineads
dreflifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqil
aeaqnagkkgw

Sequence, based on observed residues (ATOM records): (download)

>d3b48e1 c.54.1.2 (E:1-131) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
mkadillvshskmitdgikemieqmnseitihslggtsdgslgsdpmkiidtineadsdr
eflifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqilae
aqnagkkgw

SCOP Domain Coordinates for d3b48e1:

Click to download the PDB-style file with coordinates for d3b48e1.
(The format of our PDB-style files is described here.)

Timeline for d3b48e1: