Lineage for d1a0zd_ (1a0z D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531125Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries)
  8. 531257Domain d1a0zd_: 1a0z D: [15482]
    Other proteins in same PDB: d1a0za_, d1a0zc_
    complexed with hem; mutant

Details for d1a0zd_

PDB Entry: 1a0z (more details), 2 Å

PDB Description: hemoglobin (val beta1 met) mutant

SCOP Domain Sequences for d1a0zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0zd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1a0zd_:

Click to download the PDB-style file with coordinates for d1a0zd_.
(The format of our PDB-style files is described here.)

Timeline for d1a0zd_: