Lineage for d1a0zd_ (1a0z D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 329Species Human (Homo sapiens) [TaxId:9606] [46501] (71 PDB entries)
  8. 398Domain d1a0zd_: 1a0z D: [15482]
    Other proteins in same PDB: d1a0za_, d1a0zc_

Details for d1a0zd_

PDB Entry: 1a0z (more details), 2 Å

PDB Description: hemoglobin (val beta1 met) mutant

SCOP Domain Sequences for d1a0zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0zd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1a0zd_:

Click to download the PDB-style file with coordinates for d1a0zd_.
(The format of our PDB-style files is described here.)

Timeline for d1a0zd_: