| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) ![]() active dimer is formed by strand 5 swapping |
| Family c.54.1.2: DhaM-like [159618] (2 proteins) probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily (82549) automatically mapped to Pfam PF03610 |
| Protein Uncharacterized protein EF1359 [159619] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [159620] (1 PDB entry) Uniprot Q835L8 1-132 |
| Domain d3b48b_: 3b48 B: [154819] automated match to d3b48a1 |
PDB Entry: 3b48 (more details), 2.21 Å
SCOPe Domain Sequences for d3b48b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b48b_ c.54.1.2 (B:) Uncharacterized protein EF1359 {Enterococcus faecalis [TaxId: 1351]}
mkadillvshskmitdgikemieqmnaseeitihslggtsdgslgsdpmkiidtineads
dreflifadlgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqil
aeaqnagkkgwn
Timeline for d3b48b_: