SCOPe 2.08: Domain d3b45a_: 3b45 A:

Lineage for d3b45a_ (3b45 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.51: Rhomboid-like [144090] (1 superfamily)
   6 transmembrane helices

4. Superfamily f.51.1: Rhomboid-like [144091] (2 families)

5. Family f.51.1.1: Rhomboid-like [144092] (3 proteins)
   Pfam PF01694; transmembrane serine protease

6. Protein GlpG [144095] (1 species)

7. Species Escherichia coli [TaxId:562] [144096] (19 PDB entries)
   Uniprot P09391 91-272

8. Domain d3b45a_: 3b45 A: [154817]
   automated match to d2ic8a1
   complexed with bng

Details for d3b45a_

PDB Entry: 3b45, 1.9 Å

PDB Description: crystal structure of glpg at 1.9a resolution

PDB Compounds: (A:) glpG

SCOPe Domain Sequences for d3b45a_:

Sequence; same for both SEQRES and ATOM records:

>d3b45a_ f.51.1.1 (A:) GlpG {Escherichia coli [TaxId: 562]}
eragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmh
ilfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgy
vwlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsl

Timeline for d3b45a_:

• d3b45a_ first appeared in SCOP 1.75, called d3b45a1
  
• d3b45a_ appears in SCOPe 2.07