![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
![]() | Protein Cholesterol oxidase [54375] (3 species) |
![]() | Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries) |
![]() | Domain d3b3ra2: 3b3r A:319-450 [154816] Other proteins in same PDB: d3b3ra1, d3b3ra3 automatically matched to d1b8sa2 complexed with fae, gol, so4; mutant |
PDB Entry: 3b3r (more details), 0.98 Å
SCOPe Domain Sequences for d3b3ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b3ra2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]} gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqiapmpagletwvslyla itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk afaddfcyqplg
Timeline for d3b3ra2: