Lineage for d3b3qf2 (3b3q F:81-291)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050810Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2050836Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 2050842Species Human (Homo sapiens) [TaxId:9606] [158985] (1 PDB entry)
  8. 2050844Domain d3b3qf2: 3b3q F:81-291 [154814]
    Other proteins in same PDB: d3b3qa_, d3b3qb_, d3b3qe3, d3b3qf3
    automated match to d1c4rg_
    complexed with ca, nag

Details for d3b3qf2

PDB Entry: 3b3q (more details), 2.4 Å

PDB Description: crystal structure of a synaptic adhesion complex
PDB Compounds: (F:) NRXN1 protein

SCOPe Domain Sequences for d3b3qf2:

Sequence, based on SEQRES records: (download)

>d3b3qf2 b.29.1.4 (F:81-291) Ligand-binding domain of neurexin 1beta {Human (Homo sapiens) [TaxId: 9606]}
ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
v

Sequence, based on observed residues (ATOM records): (download)

>d3b3qf2 b.29.1.4 (F:81-291) Ligand-binding domain of neurexin 1beta {Human (Homo sapiens) [TaxId: 9606]}
ghttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylelh
ihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypagr
qltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev

SCOPe Domain Coordinates for d3b3qf2:

Click to download the PDB-style file with coordinates for d3b3qf2.
(The format of our PDB-style files is described here.)

Timeline for d3b3qf2: