Lineage for d3b3na_ (3b3n A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049000Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1049001Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 1049002Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1049003Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1049200Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (98 PDB entries)
    Uniprot P29476 298-716
  8. 1049316Domain d3b3na_: 3b3n A: [154811]
    automated match to d1om4b_
    complexed with act, h4b, hem, ji2, zn

Details for d3b3na_

PDB Entry: 3b3n (more details), 1.98 Å

PDB Description: Structure of neuronal NOS heme domain in complex with a inhibitor (+-)-N1-{cis-4'-[(6"-aminopyridin-2"-yl)methyl]pyrrolidin-3'-yl}ethane-1,2-diamine
PDB Compounds: (A:) Nitric-oxide synthase

SCOPe Domain Sequences for d3b3na_:

Sequence, based on SEQRES records: (download)

>d3b3na_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Sequence, based on observed residues (ATOM records): (download)

>d3b3na_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlptkdqlfplakefldqyyssi
krfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvfda
rdcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqpd
gstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpirhp
kfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynilee
vakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrcr
ggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOPe Domain Coordinates for d3b3na_:

Click to download the PDB-style file with coordinates for d3b3na_.
(The format of our PDB-style files is described here.)

Timeline for d3b3na_: