Lineage for d3b3ma1 (3b3m A:299-716)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878765Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 878766Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 878767Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 878768Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 878957Species Rat (Rattus norvegicus) [TaxId:10116] [82821] (33 PDB entries)
    Uniprot P29476 298-716
  8. 878964Domain d3b3ma1: 3b3m A:299-716 [154809]
    automatically matched to d1om4b_
    complexed with act, h4b, hem, ji1, zn

Details for d3b3ma1

PDB Entry: 3b3m (more details), 1.95 Å

PDB Description: Structure of neuronal NOS heme domain in complex with a inhibitor (+-)-3-{cis-4'-[(6"-aminopyridin-2"-yl)methyl]pyrrolidin-3'-ylamino}propan-1-ol
PDB Compounds: (A:) Nitric-oxide synthase

SCOP Domain Sequences for d3b3ma1:

Sequence, based on SEQRES records: (download)

>d3b3ma1 d.174.1.1 (A:299-716) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Sequence, based on observed residues (ATOM records): (download)

>d3b3ma1 d.174.1.1 (A:299-716) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlptkdqlfplakefldqyyssi
krfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvfda
rdcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqpd
gstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpirhp
kfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynilee
vakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrcr
ggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOP Domain Coordinates for d3b3ma1:

Click to download the PDB-style file with coordinates for d3b3ma1.
(The format of our PDB-style files is described here.)

Timeline for d3b3ma1: